PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO95062
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family HD-ZIP
Protein Properties Length: 253aa    MW: 29077.5 Da    PI: 5.1866
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO95062genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-193488256
              T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
  Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
              +++++f++eq++ Le+ Fe++ ++  +++ +LA++lgL+ rqV +WFqNrRa++k
  OMO95062 34 KNKRRFSDEQIRLLESIFESETKLEPRKKLQLARELGLQPRQVAIWFQNRRARWK 88
              56789*************************************************9 PP

2HD-ZIP_I/II124.74.3e-4035126293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  +krr+s+eq++lLE+ Fe+e+kLep++K +lareLglqprqva+WFqnrRAR+k+kq+E+dy++L+++yd+l+++ e+L++e+++L  +l++
     OMO95062  35 NKRRFSDEQIRLLESIFESETKLEPRKKLQLARELGLQPRQVAIWFQNRRARWKSKQIEQDYRTLRDNYDNLASKFESLKNEKQALMLQLQN 126
                  79************************************************************************************999876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    
MERGCVPGTE EAIIIAEELE ATQNQRKKKN YKMKNKRRFS DEQIRLLESI FESETKLEPR  60
KKLQLARELG LQPRQVAIWF QNRRARWKSK QIEQDYRTLR DNYDNLASKF ESLKNEKQAL  120
MLQLQNLSEL LAEPHEINDK GGKGVDGSSN GGGSEAEAEA EPPPKPSFQQ EGLMEDRGFL  180
GLQENDRKKI EHAGKQPAEE DYMGNESPAS PEKLYGFDSA AFRQGRSYLF GYIIEYFVDK  240
HSWEINGLAS SEE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18391RRARWKSKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.14e-40HD-ZIP family protein