PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO87521
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family TALE
Protein Properties Length: 379aa    MW: 42454.8 Da    PI: 5.4509
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO87521genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.37e-102993361954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yp+ +e+  LA+++gL+++qV++WF N R +
  OMO87521 299 FEHflHPYPTDSEKLMLASQTGLSKNQVSNWFINARVR 336
               564459******************************88 PP

2BELL103.71.3e-33162232272
      BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               ++elq++ akL+ lleeV+ rY++y++q++ v+ssFea ag+g+ak Yt+lAl+a+SrhF +L+dai+ qi
  OMO87521 162 KNELQIRLAKLIGLLEEVEVRYEKYYQQMEEVVSSFEALAGIGAAKCYTALALQAMSRHFCSLRDAIITQI 232
               689******************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    
MDLLPAPIVT EESEISQTRH LMDLLGAANE TNRHAQRLSL SLGSHMFAPN SLNSNMASSS  60
YLIPAEEDRQ VCNPAGVSDD YSFTGSPFAS SSSTSLHRSF ANSIGNSRYL RPTQSLLDEA  120
VNVGGSNVED HFFGKLYLGG VSRLSSELKA EFCSNEISLS DKNELQIRLA KLIGLLEEVE  180
VRYEKYYQQM EEVVSSFEAL AGIGAAKCYT ALALQAMSRH FCSLRDAIIT QINVIRRKFS  240
HDLPKINRGL SQLSLFDRDS RQNRLSLQQL GMIPSQRQAW RPIRGLPETS VAILRSWLFE  300
HFLHPYPTDS EKLMLASQTG LSKNQVSNWF INARVRLWKP MIEEMYKEEF ADSPQDSESD  360
PSLACTSMGR ESIADQAED
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.11e-102TALE family protein