PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO87520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family TALE
Protein Properties Length: 686aa    MW: 75620.9 Da    PI: 6.4069
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO87520genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-094324691954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yp+ +e+  LAk++gL+ +qV +WF N R +
  OMO87520 432 FEHflHPYPKDSEKIMLAKQTGLSRNQVANWFINARVR 469
               664459******************************88 PP

2BELL130.65.2e-42295366172
      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               erqelq+kk+kLls+l+eVd+rY+qy++q+++v+ssF++vag g+akpYt+lAl++iSrhFrcL+dai++qi
  OMO87520 295 ERQELQNKKTKLLSMLDEVDRRYRQYYHQMKIVVSSFDMVAGSGAAKPYTALALQTISRHFRCLRDAISGQI 366
               79*********************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 686 aa     Download sequence    
MATYYPNFSY QRDNLSTTYL GDQKPVSYLE SPSDPGNSPI YLNQASTTGA FSEILSGSSL  60
SLQNCVQIPS IGGRNEMSFI PPSTEAVSLQ SVDGQLNITS STSICNSVAA PVLPRSVLDG  120
EQSSQSQGLS LSLGSQSQIS SGVPVPSLHY QYQGYSSLFS GHLPFSGKGT IPFTGDESKR  180
SKELKISDGM NCGYTGGNND AFEIDALSNP QGSINQKQMH SEIYQFESGF STTILNSRYL  240
RVAQELLDEV VNVRKALKQP DTDKNASSQL KSSNGMSSEP SESVNNSSSD ISPAERQELQ  300
NKKTKLLSML DEVDRRYRQY YHQMKIVVSS FDMVAGSGAA KPYTALALQT ISRHFRCLRD  360
AISGQIQQTQ KSLGEQENSS NNQGGVIPRL RYVDHQLRQQ RALQQLGVMR NAWRPQRGLP  420
ESSVSILRAW LFEHFLHPYP KDSEKIMLAK QTGLSRNQVA NWFINARVRL WKPMIEEMYK  480
EEFGEMDSNF KTSLENAAKA ARENSATSED KGEEFQESMT SKTADADNVQ PGQVQYLKPD  540
HITDVELNRP TARSMFQSFA TGDAGSPSGT KLQFNQRSNV EGNNPYSNTI IPASQHGHGS  600
LMTGDAMYDL TELSNFAVGG QVSLALGLRH HENNVFPMSG DTNMRGSNKV ASSVGPETVD  660
FHCMDPGNEQ DRSRKKKRVT EPEGDK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-110TALE family protein