PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO86015
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family HD-ZIP
Protein Properties Length: 744aa    MW: 81650 Da    PI: 5.8038
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO86015genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.92.8e-2157112156
               TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
  Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
               ++k +++t++q++eLe++F+++++p++++r eL+++lgL+ +q+k+WFqNrR+++k
  OMO86015  57 KKKYHRHTPNQIQELESFFKECPHPDEKQRMELSRRLGLESKQIKFWFQNRRTQMK 112
               79999************************************************999 PP

2START183.98.9e-582604773204
               HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS...SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT..... CS
     START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv..dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevissg..... 88 
               a++a++el+k+a+ +ep+W k      e +n++e++++f+  k   +++ea r++g+v      lve+l+d++ +W e+++    ka++++v+ssg     
  OMO86015 260 ALAAMDELIKMAQMDEPLWIKGLdgglETLNYEEYRRTFSGMKPngYTTEATRETGLVCLRGLALVETLMDVN-RWAEMFPsmisKAAIVDVLSSGtgvpr 359
               689************************************77766999**************************.*************************** PP

               .EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHH CS
     START  89 .galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvks 187
                + lq+m ae+q+lsplvp R + f+R+++q+++++w++vdvS+d++q+  + + +  +++lpSg+li++++n +skvtwveh++++++++h llr+l+++
  OMO86015 360 dNSLQVMDAEFQVLSPLVPiRQVRFLRFCKQHSEHVWAVVDVSIDPCQDAANAHIFPNCRRLPSGCLIQDMDNKYSKVTWVEHTEYDDNVVHPLLRPLLST 460
               **************************************************9999999******************************************** PP

               HHHHHHHHHHHHTXXXX CS
     START 188 glaegaktwvatlqrqc 204
               g  +ga +w+atlqrq 
  OMO86015 461 GFGFGAHRWLATLQRQS 477
               **************985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    
MDGPSELGMI GENFDPGLGV RMREDGYESR SGSDNFEGAS GDDQDAAAAD GPAAKKKKKY  60
HRHTPNQIQE LESFFKECPH PDEKQRMELS RRLGLESKQI KFWFQNRRTQ MKTQLERHEN  120
IMLRQDNDKL RAENDLLKQA MSSPICNNCG GPAVAGEISY EQHQLRIENA RLKEELNRIC  180
ALTNKFLGRP LSSSASPIPS QGINSNLELA VGRNGFGGLT NAGTTLPMGY DFGDGAMVPS  240
MKPMVSELPP YDRSAFVDAA LAAMDELIKM AQMDEPLWIK GLDGGLETLN YEEYRRTFSG  300
MKPNGYTTEA TRETGLVCLR GLALVETLMD VNRWAEMFPS MISKAAIVDV LSSGTGVPRD  360
NSLQVMDAEF QVLSPLVPIR QVRFLRFCKQ HSEHVWAVVD VSIDPCQDAA NAHIFPNCRR  420
LPSGCLIQDM DNKYSKVTWV EHTEYDDNVV HPLLRPLLST GFGFGAHRWL ATLQRQSDCL  480
AVLLCPDMPG EDSTGITSAG RKSMIKLAQR MTRNFCSGVC ASSIHRWEKV NIGSLGDDVR  540
VMTRKNVSDP GEPPGVVLSA TTSVWMPVTQ QRLFDFLRNE RMRSEWDILS NGGPMQEMVN  600
VAKGQGHGNC VSLLRGSAMN ASENNMLILQ ETWCDSSGAL VVYAPVDVSS MNLVMNGGDT  660
TYVALLPSGF AILPGISPSF HGAQPNGALL KPDSDGSGGC ILTVGFQILV NSLPSAKLTM  720
ESVDTVNNLL ACTIQKIKAA LTAT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein