PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO78653
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family HD-ZIP
Protein Properties Length: 742aa    MW: 80931.6 Da    PI: 6.7078
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO78653genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.85.9e-211873156
              TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
  Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
              +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  OMO78653 18 KKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 73
              688999***********************************************999 PP

2START208.72.2e-652264511206
               HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT CS
     START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevissg 88 
               ela++a++elvk+a+ +ep+W ks     e +n+de+l++f++  +     + +ea+r++gvv+ ++  lve+l+d++ +W e+++    + +t++vis g
  OMO78653 226 ELALAAMDELVKMAQTDEPLWIKSLeggrETLNYDEYLRSFTPCIGmkpsgFVTEASRETGVVIINSLALVETLMDSN-RWAEMFPcmiaRTSTTDVISGG 325
               5899**************************************999899**9***************************.********************** PP

               ......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHH CS
     START  89 ......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwll 181
                     galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS++s ++ +   + +  +++lpSg+++++++ng+skvtwveh++++++++h+l+
  OMO78653 326 mggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIESIRETSGaPPTYLNCRRLPSGCVVQDMPNGYSKVTWVEHAEYEESQVHQLY 426
               ******************************************************999999***************************************** PP

               HHHHHHHHHHHHHHHHHHTXXXXXX CS
     START 182 rslvksglaegaktwvatlqrqcek 206
               r+l++sg+ +ga++wvatlqrqce+
  OMO78653 427 RPLLSSGMGFGAQRWVATLQRQCEC 451
               ***********************96 PP

Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    
MDGASGDDQD AADNPPRKKR YHRHTPQQIQ ELESLFKECP HPDEKQRLEL SKRLCLETRQ  60
VKFWFQNRRT QMKTQLERHE NSLLRQENDK LRAENMSIRD AMRNPICTNC GGPAIMGDIS  120
LEEQHLRIEN ARLKDELDRV CALAGKFLGR PISALASSIA PPMPNSSLEL GVGNNGFGGL  180
STVPTTLPLG PDFASGINAL PVVPATRPTA GVTGLDRSVE RSMFLELALA AMDELVKMAQ  240
TDEPLWIKSL EGGRETLNYD EYLRSFTPCI GMKPSGFVTE ASRETGVVII NSLALVETLM  300
DSNRWAEMFP CMIARTSTTD VISGGMGGTR NGALQLMHAE LQVLSPLVPV REVNFLRFCK  360
QHAEGVWAVV DVSIESIRET SGAPPTYLNC RRLPSGCVVQ DMPNGYSKVT WVEHAEYEES  420
QVHQLYRPLL SSGMGFGAQR WVATLQRQCE CLAILMSSSV PARDHTAITA SGRRSMLKLA  480
QRMTDNFCAG VCASTVHKWN KLNAGNVDED VRVMTRKSVD DPGEPPGIVL SAATSVWLPV  540
SPQRLFDFLR DERLRSEWDI LSNGGPMQEM AHIAKGQDHG NCVSLLRASA MNANQSSMLI  600
LQETCIDAAG SLVVYAPVDI PAMHVVMNGG DSAYVALLPS GFAIVPDGPG SRGPTSNGHV  660
NGNGAAGGGA GSQRVGGSLL TVAFQILVNS LPTAKLTVES VETVNNLISC TAVTQHKARV  720
VVREEKRMTM TMRLPIPFPV PL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein