PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO78293
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family TALE
Protein Properties Length: 147aa    MW: 17122.2 Da    PI: 9.5137
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO78293genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.18.4e-10901242155
               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
               k +yp+++++  LA+ +gL+++q+ +WF N+R ++
  OMO78293  90 KWPYPTEADKIALAETTGLDQKQINNWFINQRKRH 124
               569*****************************985 PP

2ELK28.34.1e-104465122
       ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
              +LK++Llr +++++++Lk EFs
  OMO78293 44 DLKDRLLRRFGSHISTLKLEFS 65
              69*******************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    
MGQLIMKRLE GSNRPNEGGA SSEEDLSGGE IDGQDAQPRS EDRDLKDRLL RRFGSHISTL  60
KLEFSKKKKK GKLPREARQT LLDWWNVHYK WPYPTEADKI ALAETTGLDQ KQINNWFINQ  120
RKRHWKPSES MQFAVMDNLS GQFFTEE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.25e-52TALE family protein