PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO74913
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family HD-ZIP
Protein Properties Length: 98aa    MW: 11733.5 Da    PI: 10.5438
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO74913genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.1e-181467356
              --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
  Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
              ++ ++++eq++ Le+ F  n+++  e ++ LA++lg++ rqV +W+qN+Ra++k
  OMO74913 14 NKKRLNQEQVRLLEKSFDANKKLEPELKQYLANQLGVPARQVAIWYQNKRARWK 67
              56789************************************************9 PP

2HD-ZIP_I/II1032.4e-331497285
  HD-ZIP_I/II  2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85
                 +k+rl++eqv+lLE+sF++++kLepe K+ la++Lg+ +rqva+W+qn+RAR+kt+ lE dy++L+ ++++ ++e++rLek+v+
     OMO74913 14 NKKRLNQEQVRLLEKSFDANKKLEPELKQYLANQLGVPARQVAIWYQNKRARWKTQSLELDYNTLQVKLENAVSEKRRLEKDVK 97
                 79*******************************************************************************986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    
MDFQTQKLYA SKHNKKRLNQ EQVRLLEKSF DANKKLEPEL KQYLANQLGV PARQVAIWYQ  60
NKRARWKTQS LELDYNTLQV KLENAVSEKR RLEKDVKS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.14e-33HD-ZIP family protein