PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OMO71805 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 46aa MW: 5298.99 Da PI: 4.3481 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 30.4 | 4.8e-10 | 1 | 39 | 258 | 296 |
GRAS 258 lealeyysalfdsleaklpreseerikvErellgreivn 296 +eal+yysa++dsl+a lp+ + +k+E+ ++++ei + OMO71805 1 MEALHYYSAILDSLDAMLPKYDTRSAKMEQLYFAEEINE 39 69***********************************86 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 46 aa Download sequence |
MEALHYYSAI LDSLDAMLPK YDTRSAKMEQ LYFAEEINEL RGADKG |
Link Out ? help Back to Top | |
---|---|
Ensembl | OMO71805 |