PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO66461
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family TALE
Protein Properties Length: 644aa    MW: 70118.2 Da    PI: 6.9837
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO66461genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-094354721954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  OMO66461 435 FEHflHPYPTDTDKLMLAKQTGLSRSQVSNWFINARVR 472
               554459******************************88 PP

2BELL108.54.1e-35329395672
      BELL   6 qkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               +k k++L+s+l+eV++rYkqy++q+q+v++sFe vaglg+a+pY++lAlka+S+hFrcLk+ai++q+
  OMO66461 329 RKHKSRLISMLDEVYRRYKQYYQQMQAVVASFEYVAGLGNAAPYAHLALKAMSKHFRCLKNAITDQL 395
               5789************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    
MAEGFEPYHV PQQSRRDKLR IVAQNHPSAC IEPTGATVSL SACSALLPLY DPSLLPSDLL  60
TCAATTTSTH GGSHHVDFHH QLSAAAKNSS VCVVKEEGTV GVNFMGFVSS SSSSTPHHHN  120
PYLDPQSSLP LNPSSIQDHM NHNNNNPFVY TPQSLQNLRD FDHHGYNNGG GHEVVQVYKP  180
EPLSLNHHES SSTGQGLSLS LSSHNTHQSN LPLELNLQRY NESVTASGYV VPAAIVGGGV  240
GSASTSNDQV SRNNSIPLGP FTGYASILKG SRFLRPAQQL LEELCDVGRG IYTEKLTPDS  300
SLLEPPLMDN LVAGEITDDI PLSGNDGGRK HKSRLISMLD EVYRRYKQYY QQMQAVVASF  360
EYVAGLGNAA PYAHLALKAM SKHFRCLKNA ITDQLQFTNK AHGQISPGFL EHQPVWRPQR  420
GLPERAVTVL RAWLFEHFLH PYPTDTDKLM LAKQTGLSRS QVSNWFINAR VRLWKPMVEE  480
IHMLETRQAQ KASQKEDRNG NKSTNDHLSS ANSLASENPS TSTQRGVQDT PSKRTRSELP  540
DNIPMGSEPL NLSYNSMSSH PHVDVGVGVS MGGGGSSGGV SLTLGLHQNN GIGLSEPYPI  600
NAAQRFGLGL EVSSEGYVIG GFEAQNRHFG RDVIGGQLLH DFVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-100TALE family protein