PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO64233
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family HD-ZIP
Protein Properties Length: 224aa    MW: 25762.6 Da    PI: 4.8806
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO64233genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.61.1e-181973256
              T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
  Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
              +++++f++eq++ Le++Fe+++ +  +++ + A++lgL+ rqV +WFqN+Ra++k
  OMO64233 19 KNKRRFSDEQIKSLESMFESESRLEPRKKLQVARELGLQPRQVAIWFQNKRARWK 73
              67889*************************************************9 PP

2HD-ZIP_I/II121.25.3e-3920111293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  +krr+s+eq+k+LE++Fe+e++Lep++K ++areLglqprqva+WFqn+RAR+k+kqlE+dy+ L+++y++l+++ e+L+ke+++L  +l++
     OMO64233  20 NKRRFSDEQIKSLESMFESESRLEPRKKLQVARELGLQPRQVAIWFQNKRARWKSKQLERDYSILQSNYNNLASKFESLKKEKQALVIQLQK 111
                  79************************************************************************************999986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    
MAEPFSSMNE VTTKKKKNKN KRRFSDEQIK SLESMFESES RLEPRKKLQV ARELGLQPRQ  60
VAIWFQNKRA RWKSKQLERD YSILQSNYNN LASKFESLKK EKQALVIQLQ KLNDMLKKPK  120
EEGECCGQVT ATNSIEGDSE KGEGVNKSDS MERSEHALGV LSDDDSGIKT DYFGLEEEPN  180
LITSMVDVEP ADGSLTSSED WHGFDSDGLF DHSSSDYQWW DFWS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.14e-76HD-ZIP family protein