PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO61609
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family TALE
Protein Properties Length: 431aa    MW: 47907.1 Da    PI: 6.357
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO61609genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.41e-073784112154
               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               k +yp++e++++L +++gL+ +q+ +WF N+R +
  OMO61609 378 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 411
               469*****************************87 PP

2ELK28.82.8e-10332353122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELKh+L+++Y+++++++++E++
  OMO61609 332 ELKHELKQGYKEKIVDIREEIL 353
               9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    
MAFHHNHLSQ DLPLHHFTDQ QQQQTNQHQQ TQQLPETTAP NWLNTALLRS QQPQPPQPHA  60
AHFSDPNFLN LHTTTTASDS TAASHAPNQW LSRSSSSLLH RNHSDVIDDV AAAAAAAAAG  120
GESMIGVESG DLKNSNSETM NNNNKSEGVV VESGDGGAVN WQNARHKAEI LAHPLYEQLL  180
SAHVACLRIA TPVDQLPRID AQLAQSQHVV AKYSTLGGGT QGLVGDDKEL DQFMTHYVLL  240
LCSFKEQLQQ HVRVHAMEAV MACWEIEQSL QSLTGVSPGE GTGATMSDDD DDQVDSDANL  300
FDGGLEGADT MGFGPLVPTE SERSLMERVR QELKHELKQG YKEKIVDIRE EILRKRRAGK  360
LPGDTTSVLK AWWQSHSKWP YPTEEDKARL VQETGLQLKQ INNWFINQRK RNWHSNPSTS  420
TVLKSKRKRY A
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1409429RKRNWHSNPSTSTVLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.20.0TALE family protein