PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO59984
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family TALE
Protein Properties Length: 345aa    MW: 38911.1 Da    PI: 5.2747
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO59984genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.31.3e-082893232155
               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
               k +yp+++++  LA+ +gL+++q+ +WF N+R ++
  OMO59984 289 KWPYPTEADKLCLAEATGLDQKQINNWFINQRKRH 323
               569*****************************885 PP

2ELK36.21.3e-12243264122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELK+ LlrKYsgy+++Lk+EFs
  OMO59984 243 ELKEKLLRKYSGYISTLKHEFS 264
               9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    
MEELYGFSSS DAPVYSMETN QTGENMLSPA GNYPVVSGFP SGFAEHMFGS TATGQLLSCS  60
SGISSDADSM VPEINHDHHQ KEEVSSAIRA KIASHPLYPK LLQAYIDCQK VGAPPEIVKV  120
LDEISGESNE ICKRSTAFIP PCFGADPELD HFMATMAPIF YCLKLFLASL KEKAALLHAT  180
FSCAAWKLWI WFEYEDFECG GCRTVAAHVA ILIHDEAVGS SEEELSGGEM EALEDYQTNE  240
DRELKEKLLR KYSGYISTLK HEFSKKKKKG KLPKEARQTL LDWWNVHYKW PYPTEADKLC  300
LAEATGLDQK QINNWFINQR KRHWKPSENM QIAVMDSLYG PFFHE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.14e-72TALE family protein