PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO59112
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family TALE
Protein Properties Length: 471aa    MW: 53226 Da    PI: 8.8669
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO59112genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.5e-102983361854
               HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               lFe   ++yps +e+  LA+++gL+ +qV++WF N R +
  OMO59112 298 LFEHflHPYPSDSEKLMLARQTGLSRTQVSNWFINARVR 336
               5665569******************************88 PP

2BELL85.84.9e-28169240172
      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               er +++ k +kL  +l+eV+k+Yk y++q+q v++sF++v glg+a+pY+ lA kai++hF +Lk ai +qi
  OMO59112 169 ERIQHRLKNSKLFLMLDEVYKKYKLYCQQMQSVVASFKCVSGLGNAAPYVCLAFKAIAKHFSSLKSAILHQI 240
               688999****************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    
MAGNYDEPFH IPQQNRRNRL RVTLGNNNNH EEAQEQLPSQ QLSLLSSSSS SSHQPTFMQN  60
PRDIYYQMFN GHGLSLSLSS QHQENSINLP MNLDAEKGNG NSILGSFLKQ NGQMTSCVPL  120
GPFTGYASVL KSSKFLKPAQ QILDDFCGIN NKVFDFPLDS LADPITCSER IQHRLKNSKL  180
FLMLDEVYKK YKLYCQQMQS VVASFKCVSG LGNAAPYVCL AFKAIAKHFS SLKSAILHQI  240
RFTDKTVNNA SARKDNVPSL WTSDQIPPIH SLPFLQHPLW RSQRGLPDHA VAVLKAWLFE  300
HFLHPYPSDS EKLMLARQTG LSRTQVSNWF INARVRLWKP MVEEIHMLEL RQAQRTFSEA  360
TSQEVHDIQT KRARNNNFQT DHEQSQLQKT TSVSYKNLGD NNQHVGSVGG GNSSNFCLAL  420
SLNQNNGHID LAQPFPMNLC HNNFNFGTDG DQLSLKAGFD VERQNHHGKN F
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.15e-77TALE family protein