PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO56859
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family HD-ZIP
Protein Properties Length: 203aa    MW: 23510.7 Da    PI: 7.5696
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO56859genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox611.9e-1949103357
               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
  Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
               k++++++eq++ Le  F +++++  e++ +LA++lgL+ rqV vWFqNrRa++k+
  OMO56859  49 KKRKLSQEQVNLLELNFGNEHKLESERKDRLASELGLDPRQVAVWFQNRRARWKN 103
               45699************************************************95 PP

2HD-ZIP_I/II119.12.3e-3849139292
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  kkr+ls+eqv+lLE +F +e+kLe+erK +la+eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+a+d  + +++rLe+ev +L+e+l 
     OMO56859  49 KKRKLSQEQVNLLELNFGNEHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKKLEEEYSKLKSAHDGAVLDKCRLESEVLKLKEQLC 139
                  9***************************************************************************************996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    
MKELEDHMAL ISQMYPGVYT QMATQQGESK PRRRRKKNKG GENSLAGAKK RKLSQEQVNL  60
LELNFGNEHK LESERKDRLA SELGLDPRQV AVWFQNRRAR WKNKKLEEEY SKLKSAHDGA  120
VLDKCRLESE VLKLKEQLCE AEKEIQRLTE RVDGVSSNSP ISSSLSMEAM QEPPFLGEFG  180
VEDAFYIPEN SYIHGMEWMN LYM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13251RRRRKKNKGGENSLAGAKKR
23252RRRRKKNKGGENSLAGAKKRK
33352RRRRKKNKGGENSLAGAKKR
43353RRRRKKNKGGENSLAGAKKRK
53454RRRRKKNKGGENSLAGAKKRK
63555RRRRKKNKGGENSLAGAKKRK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.13e-66HD-ZIP family protein