PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO56821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family TALE
Protein Properties Length: 722aa    MW: 78023.4 Da    PI: 6.9276
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO56821genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-094765131954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  OMO56821 476 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 513
               664559******************************88 PP

2BELL941.3e-303534071872
      BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
               +Vd+rY++y+eq+q+v++sF+ v+g g+a pYt+lA+ka+SrhFrcLkdai+ q+
  OMO56821 353 KVDRRYNHYCEQMQMVVNSFDLVMGFGAAVPYTALAQKAMSRHFRCLKDAISAQL 407
               7***************************************************996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    
MSQDYHHQAA GIFSFSNGFD RSQEQQQQQQ HHLATQIRRD KLRVQGFEQP PPPLVGIEEE  60
ESSGLPVYET AGMLSEMFNF PPGVAAAAAT ASGELLDQSV QANYRTHRGH EWYSSNRQGV  120
VGQLGESKSH NNHHQQLPSI NADSAAAMHL FLMNPSHPRS PSPPPPPSAT SSNTLHMLMP  180
SPSNNSLQGF NVSGPGGGGG FATSTVLSPP PQFTWVHDSA QGGNTNPSEM GGTVVEGQGL  240
SLSLSSSLQH LEAAKAEELR MGDGGLLYYN QGAGGSSSAA AAQFHYKNLS GHHLQQQGGV  300
GGQNHQVHVG FGSSLGMVNV LRNSKYVKAA QELLEEFCSV GRAADRIEHQ RRKVDRRYNH  360
YCEQMQMVVN SFDLVMGFGA AVPYTALAQK AMSRHFRCLK DAISAQLKQS CELLGEKDGA  420
GTSGITKGET PRLRMLEQSL RQQRAFHQMG MMEQEAWRPQ RGLPERSVNI LRAWLFEHFL  480
HPYPSDADKH LLARQTGLSR NQVSNWFINA RVRLWKPMVE EMYQQETKEE DGDKERPNNS  540
SNNSNNNAQT STPSTTAGAG AGAGGAAAAS TPTTPTTTTP AGKRSEINAH ENDPSLIAIN  600
TQQCFSENQA KQSTIITTTT ATPPCTSTTT ATEVAPPISQ PFATTPTTHD SDIHQRLVDD  660
TCRRGSIVAA DYGTTPGNTD IGSTLIRFGT TAGDVSLTLG LRHAGNMPEK TSSFSVRDFG  720
GC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-146TALE family protein