PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO52282
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family TALE
Protein Properties Length: 340aa    MW: 38043.8 Da    PI: 5.156
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO52282genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox231.4e-072572892254
               SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                +yp++e++++L +++gL+ +q+ +WF N+R +
  OMO52282 257 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 289
               59*****************************87 PP

2ELK29.22.1e-10210231122
       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
               ELKh+L+++Y+++++++++E++
  OMO52282 210 ELKHELKQGYKEKIVDIREEIL 231
               9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    
MAFDGFLSDH AKDMHTLALN EPGASASAAA AAAAAVAADV DNWEKAKCKA EIMAHPMYDQ  60
LLEAHVACLR VATPVDQLAK IDAQLARSQE VMTKYSAAAA AAAAEEELDH FMTNYVLLLG  120
FFKDQLQQHV RVHAMEAVMA CWDLEQSLQS LTGVSPGEGT GATMSDDEDE VVDSDTSLFD  180
GSFDGIDSMG FGPLVPTETE RSLMERVRQE LKHELKQGYK EKIVDIREEI LRKRRAGKLP  240
GDTTSLLKAW WQSHSKWPYP TEEDKARLVQ ETGLQLKQIN NWFINQRKRN WHSNPSTSLK  300
SKRKRGMVLT YIPYEQLMEE FHGTNGFNHD KNSNTSDLDL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1287305RKRNWHSNPSTSLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.11e-149TALE family protein