PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO50890
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family HD-ZIP
Protein Properties Length: 268aa    MW: 30099 Da    PI: 7.4182
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO50890genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.2e-20123177256
               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
               rk+ +++keq  +Le+ F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  OMO50890 123 RKKLRLSKEQAAILEDSFKEHSTLNPKQKQALAEHLNLRPRQVEVWFQNRRARTK 177
               788899***********************************************98 PP

2HD-ZIP_I/II124.74.3e-40123211190
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                  +kk+rlskeq+++LE+sF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e Lk+++++l+een+rL+ke +eL+ +
     OMO50890 123 RKKLRLSKEQAAILEDSFKEHSTLNPKQKQALAEHLNLRPRQVEVWFQNRRARTKLKQTEVDCELLKKCCETLTEENKRLQKELQELK-S 211
                  69*************************************************************************************9.4 PP

Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    
MGFDDICNTG LNLGLGCLVK QEKYSPSDHQ QQKKKKLLLK DDQFFPSLTL GPSDDIYQLS  60
AANKLAHGES IDLHQQQQAS SISGVSSFSN SSVKKEKDIC GEEVELERMS SRVSDEDDEG  120
SPRKKLRLSK EQAAILEDSF KEHSTLNPKQ KQALAEHLNL RPRQVEVWFQ NRRARTKLKQ  180
TEVDCELLKK CCETLTEENK RLQKELQELK SLKLTTSYYM QLPAATLTMC PSCERVAGTG  240
EGPSSTSPFT IGQKSHFFNP FTHPSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172180RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.14e-68HD-ZIP family protein