PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GBG63176.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Charophyceae; Charales; Characeae; Chara
Family WRKY
Protein Properties Length: 948aa    MW: 98801.6 Da    PI: 8.3485
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GBG63176.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY82.35e-26381436359
                 -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 D +nWrKYGqK+vkgs++prsYY+Ct+++C++kk+ver++  +  + + Y+++Hnh+
  GBG63176.1 381 DCWNWRKYGQKHVKGSNHPRSYYKCTHPSCSAKKRVERTH-SGLDLSVEYKNDHNHP 436
                 99**************************************.888899*********8 PP

2WRKY1016.9e-32675733159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 +dDg++WrKYGqK vkg+ +prsYY+Ct+++Cpv+k+vers++dp++v++tYeg+H+he
  GBG63176.1 675 MDDGWRWRKYGQKYVKGKSHPRSYYKCTTPDCPVRKHVERSTQDPSMVITTYEGKHTHE 733
                 59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 948 aa     Download sequence    
MDSGVRDGGA AAPPLPPAQQ ESKVMKPTPQ RGGLSTDFST LGHSTATVSK SNSFCFSFPP  60
SSTSTATNTT SNGSGGEAIG GGEGDLTVKT EDSTALKSSS TKHFFGDKLD SDNKSSSPFL  120
SRNNSFGGLC GGNSGGSGGG KSSDADANHM LGKAAMSTSV SSAGMGASFL HHDRGNMVVG  180
VGAVGSSPRP GSPTKQPLMK ARYRNHCPGT LLTHLAPGVN PSVMLESPLL IDAPQVVPSP  240
TSGIMNFGYH ASKAYMPSDM SKETSHSSGF LIGRNQSHQR NDLSSSCLGG GGGGGGGGGG  300
GGGGGGTSPR AIPAVPIMTL TNSLQPHQET TPALTATQSH EQLPQKHQAR QEAQEERRAV  360
ARPVQGSGRS AGGFQERSAP DCWNWRKYGQ KHVKGSNHPR SYYKCTHPSC SAKKRVERTH  420
SGLDLSVEYK NDHNHPQPAM LRRSANAAAA RMRNSNLGKD SGKNSSGGPS SHLTLAIVGS  480
DRDGGWGNSG DGRELNLDGG KVTVIEGEGQ SDGEDMWTRV HDTNRHSLDD DAKSPPNVGA  540
VRLDRLNSSG DASPSNCEDG LSSAITVANS SPVCGGGGPG RSGQASARLL YPPYSGSASP  600
PHSSLSRSSF SSADMDDMED TEMELGMTTC AKRGVEGGDD LDGCKKRRKD KKEGVPRAVR  660
EPRFVIQTVS EREVMDDGWR WRKYGQKYVK GKSHPRSYYK CTTPDCPVRK HVERSTQDPS  720
MVITTYEGKH THEQPQVGLR GGSNLGCMVG PSLLGGNGNG RGSDDISTIC MNGTSNGGRN  780
GNGSRSSMIV QGAPLGQAPT LMLGNYGRIG SDDGVRSSGV GSKGGSGSLY RGYGDSGMRK  840
DDNNGAEVEL GMRVGSVDSD SMRGSDGVNG LQGVAMALVR IGGESDDEGI VRGRSLTHRF  900
DSAADGMDHR QHDGLEGVSS GSNVARARLE MAEGRGGMDN CVQPQPSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1645649KKRRK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01080.12e-32WRKY family protein