PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHT53920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YC
Protein Properties Length: 129aa    MW: 14649.9 Da    PI: 4.6457
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHT53920.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC91.48.2e-2917230101
       NF-YC  30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                 +k +edv ++s eaP+l++kace+fi eltlrsw ++eenkr  ++k d+a++++rt+  dflvdiv +de+
  PHT53920.1   1 MKDNEDVCKVSGEAPMLMAKACEMFIQELTLRSWFNTEENKRWMVQKKDVAKVIERTELIDFLVDIVHKDEI 72 
                 89*******************************************************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    
MKDNEDVCKV SGEAPMLMAK ACEMFIQELT LRSWFNTEEN KRWMVQKKDV AKVIERTELI  60
DFLVDIVHKD EIREEGTGFG PSMLGSTSSD VQNAHPPMGS EVMIRGTASS GKFELFWMLW  120
VNLTSTLLC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48590.12e-33NF-YC family protein