PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHT53916.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YC
Protein Properties Length: 195aa    MW: 20851.9 Da    PI: 6.6694
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHT53916.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC40.94.5e-137411757101
       NF-YC  57 eltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                 elt+rsw +  enkrr l+k di++a++r +ifdflvdiv +de+
  PHT53916.1  74 ELTFRSWFNM-ENKRRMLQKKDITKAIERIEIFDFLVDIVLKDEI 117
                 79*****975.799****************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    
MGGECSGNSL VPNAGTLLPS STAATGTIGG KCSGGDWILD VGTLLPTPSA VAEGMGTGRT  60
TTGGGVLDLP AQGELTFRSW FNMENKRRML QKKDITKAIE RIEIFDFLVD IVLKDEIREE  120
GTGFGPSMLG STSSGVQNFY PPIGQTAAPS EAMIRRIATS GVQNFYPPMG QTAPSEVMIR  180
RTVMPRVFPF VYIQR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48590.18e-24NF-YC family protein