PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHT53913.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YC
Protein Properties Length: 312aa    MW: 34693 Da    PI: 8.2111
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHT53913.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC82.45.2e-2613320430101
       NF-YC  30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                 + ++e v++++ eaP+l++k ce+f+ elt+rsw ++eenkrr l+k di++a++r +ifdf vdiv +de+
  PHT53913.1 133 MIYNEGVSKVTVEAPMLFAKECEMFMQELTFRSWFNTEENKRRMLRKKDITKAIERIEIFDFQVDIVLKDEI 204
                 7789*****************************************************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    
MLYGAECWPV KNSHIQKLKV AEMRILLWMC ALTREDRVKN GINRAKVGVA SVKNKMREVR  60
LRWFGHVMRR GTDASVRSSL WTRLHLLVSS ASGTTGLGNS AADEGILGVT TQGNQGDERF  120
LEQQTSACSY QQMIYNEGVS KVTVEAPMLF AKECEMFMQE LTFRSWFNTE ENKRRMLRKK  180
DITKAIERIE IFDFQVDIVL KDEIREEGIG FGPSMLGSTS SGVQNFYPPI RQTAAPSEAR  240
QAAKDNTNAS RGRSGQWQAA EDNINASRGS SGRWQAAEDN INACGGNSGW WQDAEDNINA  300
SGGSSALHNV DG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48590.13e-33NF-YC family protein