PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHT46326.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YC
Protein Properties Length: 159aa    MW: 16838 Da    PI: 4.8788
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHT46326.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC46.48.8e-1524064102
       NF-YC  64 lhaeenkrrtlkksdiaaavtrtdifdflvdivprdelk 102
                 +h+eenkrrtl+k+diaa+++rtd+fdflvdi+prde+k
  PHT46326.1   2 IHSEENKRRTLQKNDIAAVISRTDTFDFLVDIIPRDEVK 40 
                 79**********************************875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    
MIHSEENKRR TLQKNDIAAV ISRTDTFDFL VDIIPRDEVK DEGVGLGVAP GGVPYYYPPL  60
GQPAPGGVML GRPAVPAGVV SGAVPGVVPG TVPGTVPGVD PSMYVPHLPF QVWKSMWQIS  120
EDHSYPSGGG SSSGQGTDDS QIEDGRVVHE MRFCGLALR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1915RRTLQKN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48590.13e-22NF-YC family protein