PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHT46325.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YC
Protein Properties Length: 287aa    MW: 31942.5 Da    PI: 6.7775
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHT46325.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC1178.9e-3717330102
       NF-YC  30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdelk 102
                 +kadedv+mi ae+Pvl++kace+fi eltlrsw+h+eenkrrtl+k+diaaa++rtd+fdflvdi+prde+k
  PHT46325.1   1 MKADEDVRMILAETPVLFAKACEMFIQELTLRSWIHSEENKRRTLQKNDIAAAISRTDTFDFLVDIIPRDEVK 73 
                 9*********************************************************************875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    
MKADEDVRMI LAETPVLFAK ACEMFIQELT LRSWIHSEEN KRRTLQKNDI AAAISRTDTF  60
DFLVDIIPRD EVKDEGVGLG LAPGGVPYYY PPLGQPAPGG VMLGRPAVPA GVVPGAVPGV  120
VPGTVLGTLR ALFLVLFPVL IHQCMCLICR SRCGNQCGRH QRIIRILVEV EVAVDRVPMT  180
AKSEVKLEVM EGNVISLSIV NSRVATVAWL IVFSGMATMK YDILLLDHNI KFSLWQVKMR  240
DVLAQMDLEE ALLGFDKMPS SWTDEDKWRK DQKALSQIHL HLSNQIL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14248RRTLQKN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48590.14e-43NF-YC family protein