PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHT45242.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YC
Protein Properties Length: 455aa    MW: 52093.4 Da    PI: 8.4857
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHT45242.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC23.89.7e-083534391399
       NF-YC  13 atdfknhelPlarikkilkade.dvkmisaeaPvllskacelfileltlrswlhaeenkrrt.lkksdiaaavtrtdifdflvdivprd 99 
                 +++ +  ++P  ri +i+k ++ d++m+  ea  ++ ka e f lel  r    +   +r++ +  + ++ +v++   fdfl d vp++
  PHT45242.1 353 KSESALYQFPQNRIYRIIKNENaDIRML-QEATFVVNKATEKF-LELFCREAYACSFLDRNSyVGYNHLSLVVSKRPRFDFLSDFVPQK 439
                 45566789***********865278877.69***********9.699999877777777765278999******************986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    
MPKKSNGNSD NHDGDEPEIF VISSSSTESQ DSVENEEESD GAQSVDNEYV IDSDEEEEEE  60
EEENVVESKK DLDVEKKVYR RHGNKEDENE GKRGKKTVGS SEQSESENLK TYMRKKKNQN  120
EEEKEEEVEE KEQNVPANMA KRKKEKNDKA KKEDKVKEEK IGKTAKSNED SSRGGKNEKK  180
NKKDEKREVA NKAKSNGGEI KKEENKKKKR EEKREREGQS AKKVKSNGGK IEKEENKKKK  240
RAEEAETEGK SPTKAKSNGD LSQLKKEEKK TKKTQNKKEG GEEAEEKLVK KSNSNGVASP  300
ATKEKMKKDK EKESKANNGK VNNEARSNGT PQKNEEKKLK AKKKRDDDEE NEKSESALYQ  360
FPQNRIYRII KNENADIRML QEATFVVNKA TEKFLELFCR EAYACSFLDR NSYVGYNHLS  420
LVVSKRPRFD FLSDFVPQKV RAEDALGEIP KAEES
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114143RKKKNQNEEEKEEEVEEKEQNVPANMAKRK
2114155RKKKNQNEEEKEEEVEEKEQNVPANMAKRKKEKNDKAKKEDK
3141182RKKKNQNEEEKEEEVEEKEQNVPANMAKRKKEKNDKAKKEDK
4206247RKKKNQNEEEKEEEVEEKEQNVPANMAKRKKEKNDKAKKEDK
5207248RKKKNQNEEEKEEEVEEKEQNVPANMAKRKKEKNDKAKKEDK
6237278RKKKNQNEEEKEEEVEEKEQNVPANMAKRKKEKNDKAKKEDK
7238279RKKKNQNEEEKEEEVEEKEQNVPANMAKRKKEKNDKAKKEDK
8269310RKKKNQNEEEKEEEVEEKEQNVPANMAKRKKEKNDKAKKEDK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.14e-25NF-YC family protein