PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHT43859.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YC
Protein Properties Length: 120aa    MW: 13352.5 Da    PI: 10.5258
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHT43859.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC26.91e-08281061997
       NF-YC  19 helPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivp 97 
                  ++P+ ri + l+  + v++i +eaP++l+   e++  e+   + + a++nkr+ +    i+ +v + +  + l+d+v+
  PHT43859.1  28 LQFPVGRIAHFLRIGKYVQRIVTEAPIFLAADFEYLATEVLEIAGNVARDNKRSRIVPRHIQLTVRHDEELNTLLDDVI 106
                 589*****************************************************************99999999886 PP

Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    
MATKGKTLTF DSSPSGKKSL ARSKKAGLQF PVGRIAHFLR IGKYVQRIVT EAPIFLAADF  60
EYLATEVLEI AGNVARDNKR SRIVPRHIQL TVRHDEELNT LLDDVIICSS GVIPKNHKNL