PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHT40995.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YC
Protein Properties Length: 273aa    MW: 30193.8 Da    PI: 4.8805
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHT40995.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC53.36.3e-1716912398
       NF-YC 23 larikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                 arikki++adedv +i+  +Pvl+ska elf+ +l  r++  +     +t++   ++ +v++ ++fdfl ++v +
  PHT40995.1 16 WARIKKIMQADEDVGKIAMAVPVLVSKALELFLQDLCDRTYDITLRRGAKTVNSLHLKHCVQSYNVFDFLREVVSK 91
                69*********************************************************************99976 PP

Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    
MGTLYAPQIH FVGLYWARIK KIMQADEDVG KIAMAVPVLV SKALELFLQD LCDRTYDITL  60
RRGAKTVNSL HLKHCVQSYN VFDFLREVVS KVPDYGHSDA AGETPKRRLG SFSLSYDIQE  120
MSPACNSGRG RGRGRGRGRG RVSRADRELS RPDMQLESCA TVQQSGQQNP NPGTQTENSA  180
EPEGSPKQDS TVCDKETSVI TAPSLKVNVD YSIDKPAAPE IAACTPSPKP ANEKAEEGPQ  240
WSLEMDRMVI DPTHMSQLNT SVAEEEEDYD EEE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1129138RGRGRGRGRG
2129139RGRGRGRGRGR
3131140RGRGRGRGRG
4131141RGRGRGRGRGR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.12e-51NF-YC family protein