PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PHT34845.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YC
Protein Properties Length: 291aa    MW: 32008.5 Da    PI: 4.7243
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PHT34845.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC60.53.5e-196861898
       NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                ++++P arikki++adedv +i+  +P l+ska elf+ +l  r++  + ++  +t++   +++++++ ++fdfl d+v r
  PHT34845.1  6 DTRFPAARIKKIMQADEDVGKIAMAVPLLVSKALELFLQDLCDRTYDITLKKGAKTMNSFHLKQCIQSFNVFDFLKDVVSR 86
                5789**************************************************************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    
MRKRLDTRFP AARIKKIMQA DEDVGKIAMA VPLLVSKALE LFLQDLCDRT YDITLKKGAK  60
TMNSFHLKQC IQSFNVFDFL KDVVSRVPDL GGSDAGAESA TKRRKVADED DHDSDDDIKR  120
NHTNETANNS SSGRGRGRGR GRGRGRGARA AEKGDSNVHS EKLEDPAGVS HQKDDEKPKQ  180
NDERMVDYVA EPAADTKNIS AAKSSEAVPA RNFDLNIDLN ESVESTPIPS DAPSSSTAPP  240
PPEVLLPPEV KHEEIPGWSL SEMEKMAIDP IQLANLNKGL DEEEEDYDEE G
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134143RGRGRGRGRG
2134144RGRGRGRGRGR
3136145RGRGRGRGRG
4136146RGRGRGRGRGR
5138147RGRGRGRGRG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G19490.11e-58NF-YC family protein