PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027127660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 679aa    MW: 73146.7 Da    PI: 6.7136
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027127660.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.46.2e-33265322260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers+ +++++ei+Y+g Hnh+k
  XP_027127660.1 265 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSQ-EGHITEIIYKGAHNHPK 322
                     8****************************************.***************85 PP

2WRKY103.89.2e-33474532159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnh+
  XP_027127660.1 474 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCTVRKHVERASHDLKSVITTYEGKHNHD 532
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    
MGPVEHSASA SSDQKDGSQG GAAVDQTGKF SSMSEQRMSS RGGLMERMAA RAGFNAPRLN  60
TESIRPPDLS QNLEVRSPYL TIPPGLSPTT LLDSPVFLTN SLVQPSPTTG KLGFLMSGSS  120
RNATVTEFPD KSKENCFQNV NTSSFAFRPI LESGPPLFFG ASNRITSTNL PQQPFPSIEV  180
SVQSGNTLPP RSVEHAKSAA LNQPADFSRP SAAKDTVHND ILSEPSSFQN VGGGSEHSPP  240
LDEQQEDDAD QRGGGDQNIS GAPAEDGYNW RKYGQKQVKG SEYPRSYYKC THPNCPVKKK  300
VERSQEGHIT EIIYKGAHNH PKPPPNRRSA LGSSNTLSDL LVENSEQVAM GADGNPGWTT  360
MQKGNFDWRH DNLEETSSAA LGPEYGNGTT SLQAQNGSQL ESGDGVDGSS TFSNDEDDED  420
RGTHGSVSLG YDEGDESESK RRKIESYATD MSGATRAIRE PRVVVQTTSE VDILDDGYRW  480
RKYGQKVVKG NPNPRSYYKC TSAGCTVRKH VERASHDLKS VITTYEGKHN HDVPAARNSS  540
HVNSGISGTL PAQAGAAVQS HVHRPEPSQL HNCIAQFERP PLGSFALPGR PPLGPTHGFG  600
FGMNQQGLPN MTLAGLGPPN QGKIPALPVH PYLGQPRPMN EMGRMLPKGE PKMEPMSDPG  660
LNLSNGSSVY HMSRLPLGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY family protein