PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027127657.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 722aa    MW: 77779.9 Da    PI: 6.3657
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027127657.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.36.7e-33308365260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers+ +++++ei+Y+g Hnh+k
  XP_027127657.1 308 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSQ-EGHITEIIYKGAHNHPK 365
                     8****************************************.***************85 PP

2WRKY103.79.9e-33517575159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnh+
  XP_027127657.1 517 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCTVRKHVERASHDLKSVITTYEGKHNHD 575
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    
MGEFDDHVAI IGDWMPPSPS PRALFSTLLG DDVSLRMVAE PTSENKAGFS FPGPVEHSAS  60
ASSDQKDGSQ GGAAVDQTGK FSSMSEQRMS SRGGLMERMA ARAGFNAPRL NTESIRPPDL  120
SQNLEVRSPY LTIPPGLSPT TLLDSPVFLT NSLVQPSPTT GKLGFLMSGS SRNATVTEFP  180
DKSKENCFQN VNTSSFAFRP ILESGPPLFF GASNRQPFPS IEVSVQSGNT LPPRSVEHAK  240
SAALNQPADF SRPSAAKDTV HNDILSEPSS FQNVGGGSEH SPPLDEQQED DADQRGGGDQ  300
NISGAPAEDG YNWRKYGQKQ VKGSEYPRSY YKCTHPNCPV KKKVERSQEG HITEIIYKGA  360
HNHPKPPPNR RSALGSSNTL SDLLVENSEQ VAMGADGNPG WTTMQKGNFD WRHDNLEETS  420
SAALGPEYGN GTTSLQAQNG SQLESGDGVD GSSTFSNDED DEDRGTHGSV SLGYDEGDES  480
ESKRRKIESY ATDMSGATRA IREPRVVVQT TSEVDILDDG YRWRKYGQKV VKGNPNPRSY  540
YKCTSAGCTV RKHVERASHD LKSVITTYEG KHNHDVPAAR NSSHVNSGIS GTLPAQAGAA  600
VQSHVHRPEP SQLHNCIAQF ERPPLGSFAL PGRPPLGPTH GFGFGMNQQG LPNMTLAGLG  660
PPNQGKIPAL PVHPYLGQPR PMNEMGRMLP KGEPKMEPMS DPGLNLSNGS SVYHMSRLPL  720
GP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY family protein