PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027127654.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 730aa    MW: 78634.9 Da    PI: 6.3657
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027127654.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.36.8e-33316373260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers+ +++++ei+Y+g Hnh+k
  XP_027127654.1 316 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSQ-EGHITEIIYKGAHNHPK 373
                     8****************************************.***************85 PP

2WRKY103.71e-32525583159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnh+
  XP_027127654.1 525 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCTVRKHVERASHDLKSVITTYEGKHNHD 583
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 730 aa     Download sequence    
MGEFDDHVAI IGDWMPPSPS PRALFSTLLG DDVSLRMVAE PTSENKAGFS FPGPVEHSAS  60
ASSDQKDGSQ GGAAVDQTGK FSSMSEQRMS SRGGLMERMA ARAGFNAPRL NTESIRPPDL  120
SQNLEVRSPY LTIPPGLSPT TLLDSPVFLT NSLVQPSPTT GKLGFLMSGS SRNATVTEFP  180
DKSKENCFQN VNTSSFAFRP ILESGPPLFF GASNRITSTN LPQQPFPSIE VSVQSGNTLP  240
PRSVEHAKSA ALNQPADFSR PSAAKDTVHN DILSEPSSFQ NVGGGSEHSP PLDEQQEDDA  300
DQRGGGDQNI SGAPAEDGYN WRKYGQKQVK GSEYPRSYYK CTHPNCPVKK KVERSQEGHI  360
TEIIYKGAHN HPKPPPNRRS ALGSSNTLSD LLVENSEQVA MGADGNPGWT TMQKGNFDWR  420
HDNLEETSSA ALGPEYGNGT TSLQAQNGSQ LESGDGVDGS STFSNDEDDE DRGTHGSVSL  480
GYDEGDESES KRRKIESYAT DMSGATRAIR EPRVVVQTTS EVDILDDGYR WRKYGQKVVK  540
GNPNPRSYYK CTSAGCTVRK HVERASHDLK SVITTYEGKH NHDVPAARNS SHVNSGISGT  600
LPAQAGAAVQ SHVHRPEPSQ LHNCIAQFER PPLGSFALPG RPPLGPTHGF GFGMNQQGLP  660
NMTLAGLGPP NQGKIPALPV HPYLGQPRPM NEMGRMLPKG EPKMEPMSDP GLNLSNGSSV  720
YHMSRLPLGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY family protein