PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027120200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 419aa    MW: 45236.6 Da    PI: 6.7924
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027120200.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.65.2e-33217275159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+s+fprsYYrCts++C vkk+vers+ dp++v++tYeg+H h+
  XP_027120200.1 217 LDDGYRWRKYGQKAVKNSPFPRSYYRCTSPSCGVKKRVERSSGDPTTVVTTYEGTHMHP 275
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    
MEKDKRLEKN IKPENPMSNL TFSDQIPIPA TLAAIPNIYD IPIGSAPMAS SPPPSYGGGG  60
GGAAHPHDHD MVKMESFGFI DMLTVPDYPC PSIYEMVFQQ LPPMKFQSPP LSQPLLQPQS  120
PLPPPPPPSN HINNNNAPPE SSDVATTPAT PNSPSVSTSS SDAQNDDQQQ NKTPVEGEQE  180
DRDQDKTKKH LKPKKKNQKG QKEPRFAFMT KSEVDHLDDG YRWRKYGQKA VKNSPFPRSY  240
YRCTSPSCGV KKRVERSSGD PTTVVTTYEG THMHPTPLTS RGSLGLVAES SASFICGPSG  300
VGSSNGGGGA GEAVTIGAGF GGAGSGSGPG PSSFFPPPMS QYHHQQPQQF QQQQLQQLPF  360
FRVPTAPASL NFNTHSSSFA HMIVQESSYC PPPPSSFVDN GLLEDIVPSE MLIKEPKKE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.19e-42WRKY family protein