PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027120199.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 444aa    MW: 48139.9 Da    PI: 6.9438
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027120199.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.55.7e-33242300159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+s+fprsYYrCts++C vkk+vers+ dp++v++tYeg+H h+
  XP_027120199.1 242 LDDGYRWRKYGQKAVKNSPFPRSYYRCTSPSCGVKKRVERSSGDPTTVVTTYEGTHMHP 300
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    
MEKDKRLEKN IKPENPMSNL TFSDQIPIPA TLAAIPNIYD IPIGSAPMAS SPPPSYGGGG  60
GGAAHPHDHD MVKMESFGFI DMLTVPDYPC PSIYEMVFQQ LPPMKFQSPP LSQPLLQPQS  120
PLPPPPPPSN HINNNNAPPE SSDVATTPAT PNSPSVSTSS SDAQNDDQQQ NKTPVEGEQE  180
DRDQDKTKKQ CCFSYNFFFN HQKVIFSPLP FSGISLKPKK KNQKGQKEPR FAFMTKSEVD  240
HLDDGYRWRK YGQKAVKNSP FPRSYYRCTS PSCGVKKRVE RSSGDPTTVV TTYEGTHMHP  300
TPLTSRGSLG LVAESSASFI CGPSGVGSSN GGGGAGEAVT IGAGFGGAGS GSGPGPSSFF  360
PPPMSQYHHQ QPQQFQQQQL QQLPFFRVPT APASLNFNTH SSSFAHMIVQ ESSYCPPPPS  420
SFVDNGLLED IVPSEMLIKE PKKE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.12e-41WRKY family protein