PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027106606.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 218aa    MW: 24747.4 Da    PI: 9.4628
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027106606.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY919.1e-29160213154
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYeg 54 
                     ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg
  XP_027106606.1 160 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEG 213
                     59**************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    
MEGERSASGL HLNPNYELPP SFSAPHPIPE MGFVQFEDHH QVLSFLAPSS QSSHISSQTL  60
HGGGENNHTN SSTTSNHNGS FGFRHNELVA TSTRPSWNND QVGSLNPKAV GDQNCGTNNA  120
NEGTNSWWRS SASEKGKVKV RRKLREPRFC FQTRSDVDVL DDGYKWRKYG QKVVKNSLHP  180
RSYYRCTHNN CRVKKRVERL SEDCRMVITT YEGWLVIR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139145KVRRKLR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.11e-58WRKY family protein