PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027106045.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family HB-PHD
Protein Properties Length: 883aa    MW: 97845.9 Da    PI: 4.5915
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027106045.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox345e-117137571256
                     HHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  12 leeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++L e F++n+yp+   +e LAk+lgL  +qV+ WF N R   +
  XP_027106045.1 713 VQRLLESFRENQYPKNGVKESLAKELGLRIQQVSKWFENARWSCR 757
                     68899************************************8776 PP

2PHD38.13.5e-13341396151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ Cg+   + +++++lCdg C++ fH+ Cl+++l +e++p +   wlC+ C++k
  XP_027106045.1 341 FCAKCGSkdLTLDNDIILCDGaCERGFHQFCLEPPLLKEDIPPDeeGWLCPGCDCK 396
                     699***965555********66******************999899*******985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 883 aa     Download sequence    
MNMDVVRESS LSESHLSPEQ RALELGNGFV SGNRCTESVI QKCEMVKDAH IGPEETGIRK  60
SNANSVEILK TVDGLTNNSD FESFRLHNIQ YLPESANAEP LEQKQVVGDD NVDNRLTETE  120
IAAPDLTGLE EYIQISVSPC ENVAVVPAFA SLGSEPQDAS MHVDPQQTES TQKGAVNAGG  180
ESVLDKRTPF ESRKRKSTST IPVTARVLRS RSQEKSKESE KKDVVEDAAT EAYRRKRRKK  240
KQRRNIPVNE FSRIRAHLRY LLHRIKYEQN LIDAYSGEGW KGQSLEKIKP EKELQRAKSQ  300
IFRYKLKIRD LFRQIDLLLA EGKLPESLFD SDGQIDSEDI FCAKCGSKDL TLDNDIILCD  360
GACERGFHQF CLEPPLLKED IPPDEEGWLC PGCDCKVDCI ELLSDFQGSN LSVLDKWEKV  420
FPEEAAAAAS GMKMDDYSGL PSDDSDDDDY DPDKPEVDNM VLGEESSSDE SDYFSASEEP  480
VSAVKAEQIL GLPSDDSEDD DFDPSAADHG ELAKQESSSS DFSSDSEDFG AMFHEKEPLG  540
EEAGHVSSVS TQSNLPVGSI GQIFKVGRDK RHSLSDELSF LLESNDAPVS GKRHVERLDY  600
KKLHEETYGD TSSDSSDEDY GETVGPRRRK KSTGKAILVP SNEPETIHKG ADIKDENCNQ  660
KDFEMTPVEK INKKFEIEGS NNMSVDSPRI STEGGSSGKR TGRPYQRLGD GIVQRLLESF  720
RENQYPKNGV KESLAKELGL RIQQVSKWFE NARWSCRHSS RMDSKMTGTT SINGTSLPEI  780
NEKVPKHGEQ SNLESATCNE EGKMALPQTN PCVEGQHIAG TGEGNSAIDF SPDSINGRCT  840
QVDDQMPDQL SSAEETSKQV SNVNASKSQS VRRSGRLQAR SGN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1192197SRKRKS
2234240RRKRRKK
3234242RRKRRKKKQ
4235241RRKRRKK
5236244KRRKKKQRR
6237243RRKKKQR
7626630PRRRK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.14e-91HB-PHD family protein