PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027101902.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 196aa    MW: 22099 Da    PI: 10.1913
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027101902.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.13.2e-32115173159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r + d+ +v++tYeg H h+
  XP_027101902.1 115 LDDGYRWRKYGQKGVKNNKFPRSYYRCTHPGCNVKKQVQRLSVDEGIVVTTYEGMHIHP 173
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    
MDHQHHHQGM HFLGSLVQTP ALSSISPNNE ILASSGYRLN IGDACSSREN GFPGLKAQIK  60
GPTAQVKDIF ESRTTTVAAA ANEVKSGTGS KRKGDQKKTR KPRFAFQTRS QVDILDDGYR  120
WRKYGQKGVK NNKFPRSYYR CTHPGCNVKK QVQRLSVDEG IVVTTYEGMH IHPTEKNNDN  180
FEQILNQMHI YPPLLM
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.16e-53WRKY family protein