PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027099468.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 191aa    MW: 21336.9 Da    PI: 9.9897
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027099468.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.55.5e-33111169159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H h+
  XP_027099468.1 111 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLSKDEGVVVTTYEGMHSHP 169
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    
MENYSPIFQY SSSTLTSSAS ASAAPMLLMN PMTSNATGST EHQSHDKANN GVLGLMSSVE  60
APTSGVISNL SRSSSSFVGT ETEVKSGKKK ADKKIRKPRY AFQTRSQVDI LDDGYRWRKY  120
GQKAVKNNKF PRSYYRCTHQ GCNVKKQVQR LSKDEGVVVT TYEGMHSHPI EKSTDNFEHI  180
LTQMQIYTTS F
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.13e-59WRKY family protein