PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027098610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 526aa    MW: 56967.9 Da    PI: 7.9604
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027098610.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.18.7e-34234290259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     dDgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers+ d++v+ei+Y+g+Hnh+
  XP_027098610.1 234 DDGYNWRKYGQKQVKGSEYPRSYYKCTHPSCPVKKKVERSH-DGQVTEIIYKGQHNHQ 290
                     8****************************************.***************8 PP

2WRKY1079.6e-34413471159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Cts+gC+v+k+ver+a+dpk+v++tYeg+Hnh+
  XP_027098610.1 413 LDDGYRWRKYGQKVVKGNPYPRSYYKCTSQGCNVRKHVERAASDPKAVITTYEGKHNHD 471
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    
MAENDGSSSR APTRPTISLP PRTAMESLFT GGPGASPGPM TLVSSFFSDN DPDSECRSFS  60
QLLAGAMGSP VAVPALRQNF QQPGNSSSRE KVSSSGAGDA DFRFKQSRPT GLVVTQPAMF  120
TVPPGLSPAS LLDSPGFFSS GQGAFGLSHQ QVLAQVTAQA AQGQAHMQTP AEYPSLSSAP  180
APPSSQLQSL TSSTTTPQQM PPPVPDPNII KASSDVPQLD EKLQPSITVD KPADDGYNWR  240
KYGQKQVKGS EYPRSYYKCT HPSCPVKKKV ERSHDGQVTE IIYKGQHNHQ PPQHMKRAKD  300
SGNPNGTFNL QGNSELGSMG RSENLNMNRE GFPSHSLALK DQESSQATPE QVSGSSDSEE  360
VGNAENGVET RDNDEPESKR RNIEVQTSEP ASSHRTVTEP RIIVQTTSEV DLLDDGYRWR  420
KYGQKVVKGN PYPRSYYKCT SQGCNVRKHV ERAASDPKAV ITTYEGKHNH DVPATKSSSH  480
STASMASELK PPTTLVNNQS LTRRAEFKNN GPQPIASLRF KEEQIT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-165WRKY family protein