PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027090886.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 565aa    MW: 61793.8 Da    PI: 7.1492
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027090886.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.92.1e-33232289260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  XP_027090886.1 232 EDGYNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVERSL-DGQITEIVYKGNHNHPK 289
                     7****************************************.***************85 PP

2WRKY105.62.7e-33404462159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct +gCpv+k+ver+++d ++v++tYeg+Hnh+
  XP_027090886.1 404 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCPVRKHVERASHDLRAVITTYEGKHNHD 462
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    
MAASTGTLDT ANFSFSPTSF MSTTSFTDLL ASDGYSMATS TGMAAESRGL GDRIAERTGS  60
GVPKFKSLPP PSLPISPPPV SPSSYFAIPP GLSPTELLDS PVLLSGSSVL PSPTTGSFPF  120
QAFNWKSNSY NSQQGIKQEQ KNYQDFSFQP QAAVSRPQTN TIPEGQMQQA WNYQEPAKQD  180
DPTVKSDVTS MQSFSPEIGN IQANSQGNGG FQSDYNNYNQ SSQTLSERRR SEDGYNWRKY  240
GQKQVKGSEN PRSYYKCTYP NCPTKKKVER SLDGQITEIV YKGNHNHPKP QSTRRSSASS  300
TACSVVIQPY SSQSNDVPDQ SYASTGNGQM DSVATPENSS ISIGDDDFEQ SSKSKSGGDE  360
FDDDEPDAKR WKTESESEGI SAPGSRTVRE PRVVVQTTSD IDILDDGYRW RKYGQKVVKG  420
NPNPRSYYKC TNPGCPVRKH VERASHDLRA VITTYEGKHN HDVPAARGSG SNSANRPVPS  480
SNAPMAVRPS VMSHQSNYPI PVRSFRAPPP EGQQAPYTLK MLQDPAGNYG FGNSMGSYLN  540
VPQANTFSRA KDEPRDDMFL ESLLC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-121WRKY family protein