PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027089966.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 219aa    MW: 24872.9 Da    PI: 6.84
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027089966.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.68.1e-31135193159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDg++WrKYG+K+vk++++pr+YY+C+++gC+vkk+ver+ edp+++++tYeg+Hnhe
  XP_027089966.1 135 LDDGFKWRKYGKKTVKSNPNPRNYYKCSTEGCKVKKRVERDGEDPSYLITTYEGRHNHE 193
                     59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    
MFNSTSLPPP EQGIGAHHGN VVPSSYASSD YLLEKYSNDH LGSHELLHYL DLPDHEEPLI  60
NNVHTDSNST LTACVYPTPF TREMTNITGS SANYIDGMPI NCNMHESRCM RATKMAKVDQ  120
GNIIAIRTKT QLEILDDGFK WRKYGKKTVK SNPNPRNYYK CSTEGCKVKK RVERDGEDPS  180
YLITTYEGRH NHESPCFIYC DELPLAISYG WTLRPSQYS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.18e-40WRKY family protein