PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027089877.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 220aa    MW: 24898.9 Da    PI: 6.5911
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027089877.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.44.6e-31136194159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDg++WrKYG+K+vk++++pr+YY+C+++gC+vkk+ver+aedp+++++tYeg+Hnhe
  XP_027089877.1 136 LDDGFKWRKYGKKKVKSNPNPRNYYKCSTEGCKVKKRVERDAEDPSYLVTTYEGRHNHE 194
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    
MFNSTFLPPP EPGISIHHDT VIPSTYTSDY LLDKYFTDHL GSQELSHYLD IPDHGQLLIN  60
NVHEDSNSSL TACVHPTLFT QEMTSTTGSS ASCMDGMPIN SYMEEDQSSC KRVMKRAKVD  120
QGNVIAIRTK TQLEILDDGF KWRKYGKKKV KSNPNPRNYY KCSTEGCKVK KRVERDAEDP  180
SYLVTTYEGR HNHEGPCFIY CDALPLAISY GWTLQPSQSS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.14e-39WRKY family protein