PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027089605.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 814aa    MW: 90001.6 Da    PI: 6.1182
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027089605.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.63.9e-31327384260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +Dgy+WrKYGqK+vkgse+prsYY+C  ++Cpvkkkvers+ d++++ei+Y+g Hnh+k
  XP_027089605.1 327 EDGYSWRKYGQKHVKGSEYPRSYYKCNNSNCPVKKKVERSH-DGEITEIIYKGAHNHPK 384
                     8****************************************.***************85 PP

2WRKY105.72.4e-33547605159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+CtsagCpv+k+ver+++d k v +tYeg+Hnhe
  XP_027089605.1 547 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCPVRKHVERASDDIKSVLTTYEGKHNHE 605
                     59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 814 aa     Download sequence    
MVPYNPIDSH SKDFGVRGCG RSVDHYFLLE MEVNGETFND WGALVVVDEF ESKPGEDYGE  60
TERNNIGDIC TNGVNGASDN SSININNNEN CNNDMHLDDQ SKKSSSSSSP EVEFRGSIAE  120
RRAAKFGFDA SRINVAKFEV STSPSSPLVR SPYLTIPSGL SPAALLDSPV MLPNSQPSPT  180
TGTLQLLHSN HDSFVLNSDS PAADRDKGSA IHTSNPFKPP ADPTPIISGP LSSENQLPMT  240
SKPPPESRIE ASVKSCALER SIKTNIFETM PQKANHVNSQ TPNISVVNNQ LPHLREGIKS  300
ETGIQELHRE DQKGTYPGAA EMSRNAEDGY SWRKYGQKHV KGSEYPRSYY KCNNSNCPVK  360
KKVERSHDGE ITEIIYKGAH NHPKPHPRIS LGPPSQSSEM LETSEGSEPG LKAENRTGWR  420
FNNQLIRSKD FRITSDWRPN GMERTSSTSV LTEILDPLAT TQGKSAKAFG STETPEIALT  480
AAYQDGEDDD RATQGSTSQG DEADADESEP KRRQVIFYFC TLQSYLPSRS TREPRVIVQI  540
ESEIDVLDDG YRWRKYGQKV VKGNPNPRSY YKCTSAGCPV RKHVERASDD IKSVLTTYEG  600
KHNHEVPTNK TSGLPSASNS PPDVSDPNSS LIVPRNPSIS NRELQVQDLP LHYEMKPALG  660
NHDFLRSNLL GDFVTDHMQI GASPIYQMKF PPTPLQNPLS YSTFLMNSSG SDSRVSCQKF  720
PPVVPDFPMS IPINVPRSSP NMALNNAFHS YNHNQTIPNA TAVRCQHITE GDLRFLRPKE  780
EKEDNLYETC LATPDNSNVT SSTEFCRANG NFPS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26440.14e-75WRKY family protein