PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027088028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 324aa    MW: 36512.8 Da    PI: 6.9574
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027088028.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.56.7e-34185242259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s++prsYYrCt+++Cpvkk+vers +dp +v++tYeg+Hnh+
  XP_027088028.1 185 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCPVKKRVERSFQDPAIVITTYEGTHNHH 242
                     8********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    
MSEDFRDLYY HQPYQDDRHG SINMSANFPF PHHMASSSLT DNSSVLNSSH MLDPAYMSFT  60
DCLLQGSSDQ GTFARAFGLS PSSSEAFSLV KDEQKPVVIE VAGDHQACAS HETPVTPNSS  120
ISSSSTEAVG DEDSNKGKKD KQLKETQEED ALSPKKENKP KKKGEKKERQ PRFAFMTKSE  180
VDHLEDGYRW RKYGQKAVKN SPYPRSYYRC TTQKCPVKKR VERSFQDPAI VITTYEGTHN  240
HHVPATLRGN VAGMLPPSML TPMPLGVPNF PQELIVQMPQ FYSQASANTS SMYQQNLTPL  300
QQLQFHDYGL LQDIVPSMFF KQEP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.13e-64WRKY family protein