PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027087611.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 784aa    MW: 86420.5 Da    PI: 6.2453
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027087611.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.73.7e-31297354260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +Dgy+WrKYGqK+vkgse+prsYY+C  ++Cpvkkkvers+ d++++ei+Y+g Hnh+k
  XP_027087611.1 297 EDGYSWRKYGQKHVKGSEYPRSYYKCNNSNCPVKKKVERSH-DGEITEIIYKGAHNHPK 354
                     8****************************************.***************85 PP

2WRKY105.82.3e-33517575159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+CtsagCpv+k+ver+++d k v +tYeg+Hnhe
  XP_027087611.1 517 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCPVRKHVERASDDIKSVLTTYEGKHNHE 575
                     59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 784 aa     Download sequence    
MEVNGETFND WGALVVVDEF ESKPGEDYGE TERNNIGDIC TNGVNGASDN SSININNNEN  60
GNNDVHLDDQ SKKSSSSSSP EVEFRGSIAE RRAAKFGFDA SRINVAKFEV STSPSSPLVR  120
SPYLTIPSGL SPAALLDSPV MLPNSQPSPT TGTLQLLHSN HDSSVLNSDS PAADRDKGSA  180
IHTSNPFKPP ADPTPIISGP LSSENQLPMT SKSPPESRIE ASVKSCALER SIKTNIFKTM  240
PQKANHVNSQ TPNISVVNNQ LPHLREGIKS ETGIQELHRE DQKGTYPGAA EMSRNAEDGY  300
SWRKYGQKHV KGSEYPRSYY KCNNSNCPVK KKVERSHDGE ITEIIYKGAH NHPKPHPRIS  360
LGPPSQSSEM LETSEGSEPG LKAENRTGWR FNNQLIRSKD FRITSDWRPN GMERTSSTSV  420
LTEILDPLAT TQGKSAKAFG STETPEIALT AAYQDGEDDD RATQGSTSQG DEADADESEP  480
KRRQVIFYFC TLQSYLPSRS TREPRVIVQI ESEIDVLDDG YRWRKYGQKV VKGNPNPRSY  540
YKCTSAGCPV RKHVERASDD IKSVLTTYEG KHNHEVPTNK TSGLPSASNS PPDVSDPNSS  600
LIVPRNPSIS NRELQVQDLP LHYEMKPALG NHDFLRSNLL GDFVTDHMQI GASSIYQMKF  660
PPTPLQNPLS YSTFLMNSSG SDSRVSCQKF PPVVPDFPMS IPINVPRSSP NMALNNAFHS  720
FNHNQTIPNA TAVRCQHITE GDLRFLRPKE EKEDNLYETC LATPDNSNVT SSTEFCRSNG  780
NFPS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26440.11e-75WRKY family protein