PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027083268.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 157aa    MW: 17972.6 Da    PI: 9.8318
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027083268.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.42.2e-3178136159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+  +prsYYrCt+++C+vkk+++r ++d+++v++tYeg Hnh+
  XP_027083268.1  78 LDDGYKWRKYGQKAVKNCAHPRSYYRCTHHTCNVKKQIQRLSKDTSIVVTTYEGIHNHP 136
                     59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    
MNQSMQSPQI ASDMDWATIL SSTAVDCEQK PTSPCLSMTS RNAREGDNLD KNKVKPGKTK  60
KSVPPRIAFH TRSTEDILDD GYKWRKYGQK AVKNCAHPRS YYRCTHHTCN VKKQIQRLSK  120
DTSIVVTTYE GIHNHPCEKL METLSPLLKQ LQFLSRF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64000.11e-59WRKY family protein