PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027076705.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 187aa    MW: 21499.9 Da    PI: 8.7367
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027076705.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY971.2e-30100158159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +dDgy+WrKYG+K+vk+s++pr+Y++C+s gC+vkk+ver+++dp++v++tYeg Hnhe
  XP_027076705.1 100 MDDGYKWRKYGKKMVKNSPNPRNYFKCSSGGCHVKKRVERDRDDPSYVITTYEGVHNHE 158
                     59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    
MPDISQHVDH HQHHQTSSEF QFSDYFMMQD YYSFDQDAHL ASQNTVDQYQ QNVTSNITVE  60
SNHPSATASN MKQKSGITKK RAVDMGRKVA FRTKSKLDVM DDGYKWRKYG KKMVKNSPNP  120
RNYFKCSSGG CHVKKRVERD RDDPSYVITT YEGVHNHESP CVVYHLPPMM PMGGFSLQES  180
YTPSSSS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.19e-42WRKY family protein