PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027076704.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 204aa    MW: 23247 Da    PI: 8.3199
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027076704.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.81.4e-30117175159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +dDgy+WrKYG+K+vk+s++pr+Y++C+s gC+vkk+ver+++dp++v++tYeg Hnhe
  XP_027076704.1 117 MDDGYKWRKYGKKMVKNSPNPRNYFKCSSGGCHVKKRVERDRDDPSYVITTYEGVHNHE 175
                     59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    
MDASLCMFPN PNPTAGVMPD ISQHVDHHQH HQTSSEFQFS DYFMMQDYYS FDQDAHLASQ  60
NTVDQYQQNV TSNITVESNH PSATASNMKQ KSGITKKRAV DMGRKVAFRT KSKLDVMDDG  120
YKWRKYGKKM VKNSPNPRNY FKCSSGGCHV KKRVERDRDD PSYVITTYEG VHNHESPCVV  180
YHLPPMMPMG GFSLQESYTP SSSS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.18e-42WRKY family protein