PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027074070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 228aa    MW: 26099.3 Da    PI: 9.1631
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027074070.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.72.1e-32151209159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  XP_027074070.1 151 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHIHS 209
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    
MREILNSASQ TMLNQSLFED QDMSSQLGFF AFSSNPYNLP FGCSQPSLKT LTAVAGSLAA  60
DTQTTLSESA TQKQKEDVTS HFGEPPQLRS LQRSNANLWA WGEVNDCMNS KKNGGDNYLG  120
VATIKMKKIK ARRKVREPRF CFKTLSEVDV LDDGYKWRKY GQKVVKNTQH PRSYYRCTQD  180
NCRVKKRVER LAEDPRMVIT TYEGRHIHSP SQDEDDSQAS SQMNNFFW
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.15e-58WRKY family protein