PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027073550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 511aa    MW: 55611.1 Da    PI: 8.3469
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027073550.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.82e-32241297259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK vk +e+prsYY+Ct+++Cpvkkkver++ d++v+eitY+g+Hnhe
  XP_027073550.1 241 SDGYNWRKYGQKLVKAKEHPRSYYKCTHPNCPVKKKVERAS-DGQVTEITYKGQHNHE 297
                     7****************************************.***************7 PP

2WRKY107.75.7e-34419477159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYYrCt+agC+v+k+ver++ dpk+v++tYeg+Hnh+
  XP_027073550.1 419 LDDGYKWRKYGQKVVKGNPHPRSYYRCTFAGCNVRKHVERASADPKAVITTYEGKHNHD 477
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    
MGQTEMGTET GGAAAKGQRR PTITVPPRAP FEPLFTSGSM PGYSPGPMTL LSNIFSPDSN  60
SCSFSQLLAG AMASPIGKPT FFATAGDYST ENYAAIDVNF GVGNDKGSGY KQNRPMGLVV  120
AQSPLFLVPP ALSPSGFLNS PGFLSPLQSP FGMSHQQALA HVTAQAALSQ SFVQIQADFQ  180
RASGIASAEA AELKPSSLPS ETLQEDVHSI PAEPQTLKMV PLEASQSDKK TVSFALDKPA  240
SDGYNWRKYG QKLVKAKEHP RSYYKCTHPN CPVKKKVERA SDGQVTEITY KGQHNHELPQ  300
PNTRAKDNSC LNGMMSSEVN PESGSRWQTE VTHDAATSHL NNLKQKAFTQ LSSEQFPVAS  360
EQDEREDSAT VIDEDIDDDE EPNAKRRSTE VGAGVPAPLH KTVTEPKIVV QTRSEVDLLD  420
DGYKWRKYGQ KVVKGNPHPR SYYRCTFAGC NVRKHVERAS ADPKAVITTY EGKHNHDIPA  480
GRNSGQNNVN TNTKLKPRRP VARKSSVDRE V
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-136WRKY family protein