PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027072908.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 513aa    MW: 55639.3 Da    PI: 6.6433
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027072908.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY80.12.4e-25207262359
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     DgynWrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ ++v+ei+Y+++Hnh+
  XP_027072908.1 207 DGYNWRKYGQKQVKSPQGSRSYYRCTYSECCAKK-IECSDDSNRVMEIVYRSHHNHD 262
                     9*******************************98.*********************7 PP

2WRKY79.44e-25379432259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      Dgy+WrKYGqK+vkg+++pr    CtsagCpv+k++er+++++++v+itY+g H+h+
  XP_027072908.1 379 ADGYRWRKYGQKMVKGNPHPR----CTSAGCPVRKHIERAKDNTNAVIITYKGVHDHD 432
                     6*******************6....********************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    
MDAKNFNSDN NSSNKSPSCE EEDEAAAQNS KSREEFDENS RGGGGDGYEQ VNSKTVDNSS  60
IPVVVAQMSN NRASSTPETL ATAASSDLHC KFEVAVDNEM QRLEPAEELK DQVGMSYQEE  120
FRIIADQAVP DQTQNQQEPP NGPRSSEPSP TSVTQPISSV PSPTLPEQKM SPGDNRNTSH  180
TSEADKKNSF DPKTLSVVSI QKTPSPDGYN WRKYGQKQVK SPQGSRSYYR CTYSECCAKK  240
IECSDDSNRV MEIVYRSHHN HDPPQKVNCT RGSRHSLSIA PANGSDSSVA PIGATADSAP  300
STSSKDSVQE KVSVPDPIQK DSSDSDDNAE TNIKQEREDE PEPSKRLKKT VASCSAPLLK  360
PGKKPKIVVH AASDVGISAD GYRWRKYGQK MVKGNPHPRC TSAGCPVRKH IERAKDNTNA  420
VIITYKGVHD HDMPVPKKRH GPPSAPLVAA AAPASMSTVQ VVKSETIQNQ VSATQWSVDK  480
EGGLKGQTLE CGGEKNVESA RTLLSIGFEI KPC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-107WRKY family protein