PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027072617.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 465aa    MW: 51256 Da    PI: 8.9585
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027072617.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.41.3e-32194250360
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geH h+k
  XP_027072617.1 194 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSL-DGQIAEIVYKGEHSHPK 250
                     9***************************************.***************85 PP

2WRKY102.72e-32382439259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dg++WrKYGqK+vkg+++prsYYrCts +C+v+k ver+++dp+++ +tYeg+Hnhe
  XP_027072617.1 382 RDGFRWRKYGQKVVKGNPYPRSYYRCTSLKCNVRKYVERTSDDPNAFMTTYEGKHNHE 439
                     7********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    
MEIKETEKVA IAKPVASRPT CSGFKSFSEL LAGAINASPS STCSEAAVTA IRPRTVRFKP  60
AVDHPSAGVA ASQANLCGAA VSSPTAKDLK ADGKCKVVYK PMAKLVSKTT VSLLANMRSA  120
NLFQEQELAE VEANFQLPNL VKPQCDNRSE PHQNFLSAAQ KNKRVEPSNV TTQNLEEDQR  180
SLAHTANGDR PSYDGYNWRK YGQKQVKGSE YPRSYYKCTH PNCPVKKKVE RSLDGQIAEI  240
VYKGEHSHPK TQPVRRNSSD GHWQGTSGNE SNNPLCRNQH SDKNECYEGT MENPNEFGFL  300
AHSSYSGGAP SCMHPTNGDL DNSSCHSGEF DEGREGLEGE TEGPKRKRRK NDNQSNVAGT  360
AAEGAQEPQV LGQNSTDSEI IRDGFRWRKY GQKVVKGNPY PRSYYRCTSL KCNVRKYVER  420
TSDDPNAFMT TYEGKHNHEM PTKSTSSLAA KTSTKALGTK KIYLD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1344351PKRKRRKN
2345350KRKRRK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.11e-107WRKY family protein